TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P29310|1433Z_DROME 14-3-3 protein zeta OS=Drosophila melanogaster GN=14-3-3zeta PE=1 SV=1
MSTVDKEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQ
LAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSQTAYQDAFDISK
GKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDEA
EPQEGGDN