TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P29518|BT1_MAIZE BRITTLE-1 PROTEIN PRECURSOR - Zea mays (Maize).
MAATMAVTTMVTRSKESWSSLQVPAVAFPWKPRGGKTGGLEFPRRAMFASVGLNVCPGVPAGRDPREPDPKVVRAADNCD
IAASLAPPFPGSRPPGRRGRGSEEEEAEGRRHEEAAAAGRSEPEEGQGQDRQPAPARLVSGAIAGAVSRTFVAPLETIRT
HLMVGSIGVDSMAGVFQWIMQNEGWTGLFRGNAVNVLRVAPSKAIEHFTYDTAKKFLTPKGDEPPKIPIPTPLVAGALAG
FASTLCTYPMELIKTRVTIEKDVYDNVAHAFVKILRDEGPSELYRGLTPSLIGVVPYAACNFYAYETLKRLYRRATGRRP
GADVGPVATLLIGSAAGAIASSATFPLEVARKQMQVGAVGGRQVYQNVLHAIYCILKKEGAGGLYRGLGPSCIKLMPAAG
IAFMCYEACKKILVDKEDEEEEDEAGGGEDDKKKVE