TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P29897|MAUF_PARDE METHYLAMINE UTILIZATION PROTEIN MAUF - Paracoccus denitrificans.
MVSVEDLHGLSAGQASVPDCKLFPQSPSAATRIAVLLAAALAGAAGGVALASAAGPQPLWAVLGAAAVAGGLLSTWSPCG
YSSISLLRPDGRGLRAVAGWLPTFAMHGAGYGLGALMLGGLLGGIGLIAGFSGFGSTALLVLGLVGLAYGAHQLDFLRVP
YPQRRAQVPHDARQRFPKWVIGGLYGLSLGLDYLTYVQTPLLYMMTLAAVFTGNIAHAIAIVALFNLGRFLPVAVNALPI
PDYRVQAWLARHQENAALADGAILTALGAGFTVLALI