TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P30344|MER4_STRLI MERCURY RESISTANCE PROBABLE HG TRANSPORT PROTEIN - Streptomyces lividans.
MNGLLALAFAAGMLAPVNPCGFALLPAWITAALGDSDASPLPVRLTRALRSGAALTLGFAGTLAAAGLIVSAGARALIQA
APWLGLATGILLLLLGAVMLTGRTPSLRLHLTTSTRRSAGPPTARRMAAFGVGYAAASLSCTFGVLLAVIAQAQATASFA
GLLAVFAAYAAGSAAVLLLVAVTTAAAGAALTRKITALARHGTRITAAVLVLTGAYLAWYWYPAATGGATTAAPGGGLAT
FSATATAWIQAHTTAIAVTAVVVVLAVAAAAIRHRTRQPARHSTPTGTAPSAAAADDCCAPLPVPTPASTDRDSDGHCC