TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P30692|OMB_NEISI Major outer membrane protein P.IB precursor (Protein IB) (PIB) (Porin) - Neisseria sicca
MKKSLIALTLAALPVAAMADVTLYGQVKAGVEVSRTKETVNHVSTKNKTATEIADFGSRIGFKGHEHLSNNLNAIWQVEQ
NTSVAGTDKGWGTRESFIGLEGGFGKVRAGKLNTALKDNSDSVDPWESSDANASVLQFGKLKRVDERKVSVRYDSPVFAG
FSASAQYQPRDNANPEDKHVHDVKTRHSFDLGLNYENSGFFGRYAGTFAKRKVLSDDHLELFNSNTTLGSGVYKDYQAHR
LVGGYDANNVLVSVAGQYEGFKADVADAKKNERTEVAVTGGYRMGNVMPRLSYAHGFKAKENGVKQGNSQYNQVIVGADY
DFSKRTSALVSAGWLKEGKGGDKTQSTAGLVGLRHKF