TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P30963|CCMA_BRAJA Heme exporter protein A (Cytochrome C-type biogenesis ATP-binding protein cycV) - Bradyrhizobium japonicum.
MQLSGRRVICVRGGREVFAGLDFEAVSGEAVAVVGRNGSGKTSLLRLIAGLLIPAGGTIALDGGDAELTLPEQCHYLGHR
DALKPALSVAENLSFWADFLGGERLDAHESLATVGLDHATHLPAAFLSAGQRRRLSLARLLTVRRPIWLLDEPTTALDVA
GQDMFGGLMRDHLARGGLIIAATHMALGIDSRELRIGGVA