TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P30964|CCMB_BRAJA Heme exporter protein B (Cytochrome C-type biogenesis protein CYCW) - Bradyrhizobium japonicum.
MTALSALIRRDIRIALRVGGGALIGVLFFLTVVVLMPFAVGPDLALLSRLGPAILWLGALLASLLTLDRLFMADHEDGSL
DLITMSRTPLELACAAKALAHWLAAGLPLIVATPVLGLLLNLDMVATGAVALTLLAGTPALTFTGMIGAALAVTLHRGGL
LMAVLVLPLSIPVLIFGVAASQAVIVGPMSFGAPFSILCALSLVSLVIGPFAAAASLRHGLD