TCDB is operated by the Saier Lab Bioinformatics Group
>P31141|CMLR_STRLI Chloramphenicol resistance protein - Streptomyces lividans.
MPLPLYLLAVAVCAMGTSEFMLAGLVPDIASDLGVTVGTAGTLTSAFATGMIVGAPLVAALARTWPRRSSLLGFILAFAA
AHAVGAGTTSFPVLVACRVVAALANAGFLAVALTTAAALVPADKQGRALAVLLSGTTVATVAGVPGGSLLGTWLGWRATF
WAVAVCCLPAAFGVLKAIPAGRATAAATGGPPLRVELAALKTPRLLLAMLLGALVNAATFASFTFLAPVVTDTAGLGDLW
ISVALVLFGAGSFAGVTVAGRLSDRRPAQVLAVAGPLLLVGWPALAMLADRPVALLTLVFVQGALSFALGSTLITRVLYE
AAGAPTMAGSYATAALNVGAAAGPLVAATTLGHTTGNLGPLWASGLLVAVALLVAFPFRTVITTAAPADATR