TCDB is operated by the Saier Lab Bioinformatics Group
>P31167|ADT1_ARATH ADP,ATP carrier protein 1, mitochondrial - Arabidopsis thaliana (Mouse-ear cress).
MVDQVQHPTIAQKAAGQFMRSSVSKDVQVGYQRPSMYQRHATYGNYSNAAFQFPPTSRMLATTASPVFVQTPGEKGFTNF
ALDFLMGGVSAAVSKTAAAPIERVKLLIQNQDEMIKAGRLSEPYKGIGDCFGRTIKDEGFGSLWRGNTANVIRYFPTQAL
NFAFKDYFKRLFNFKKDRDGYWKWFAGNLASGGAAGASSLLFVYSLDYARTRLANDAKAAKKGGGGRQFDGLVDVYRKTL
KTDGIAGLYRGFNISCVGIIVYRGLYFGLYDSVKPVLLTGDLQDSFFASFALGWVITNGAGLASYPIDTVRRRMMMTSGE
AVKYKSSLDAFKQILKNEGAKSLFKGAGANILRAVAGAGVLSGYDKLQLIVFGKKYGSGGA