TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P32722|PORD_PSEAE PORIN D PRECURSOR (OUTER MEMBRANE PROTEIN D2) (IMIPENEM/BASIC AMINO ACID-SPECIFIC OUTER MEMBRANE PORE) - Pseudomonas aeruginosa.
MKVMKWSAIALAVSAGSTQFAVADAFVSDQAEAKGFIEDSSLDLLLRNYYFNRDGKSGSGDRVDWTQGFLTTYESGFTQG
TVGFGVDAFGYLGLKLDGTSDKTGTGNLPVMNDGKPRDDYSRAGGAVKVRISKTMLKWGEMQPTAPVFAAGGSRLFPQTA
TGFQLQSSEFEGLDLEAGHFTEGKEPTTVKSRGELYATYAGETAKSADFIGGRYAITDNLSASLYGAELEDIYRQYYLNS
NYTIPLASDQSLGFDFNIYRTNDEGKAKAGDISNTTWSLAAAYTLDAHTFTLAYQKVHGDQPFDYIGFGRNGSGAGGDSI
FLANSVQYSDFNGPGEKSWQARYDLNLASYGVPGLTFMVRYINGKDIDGTKMSDNNVGYKNYGYGEDGKHHETNLEAKYV
VQSGPAKDLSFRIRQAWHRANADQGEGDQNEFRLIVDYPLSIL