TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P32847|B3AT_ONCMY Band 3 anion exchange protein OS=Oncorhynchus mykiss GN=slc4a1 PE=2 SV=2
MENDLSFGEDVMSYEEESDSAFPSPIRPTPPGHSGNYDLEQSRQEEDSNQAIQSIVVHTDPEAYLNLNTNANTRGDAQAY
VELNELMGNSWQETGRWVGYEENFNPGTGKWGPSHVSYLTFKSLIQLRKIMSTGAIILDLQASSLSAVAEKVVDELRTKG
EIRAADRDGLLRALLQRRSQSEGAVAQPLGGDIEMQTFSVTKQRDTTDSVEASIVLSGVMDSLEKPAVAFVRLGDSVVIE
GALEAPVPVRFVFVLVGPSQGGVDYHESGRAMAALMADWVFSLEAYLAPTNKELTNAIADFMDCGIVIPPTEIQDEGMLQ
PIIDFQKKMLKDRLRPSDTRIIFGGGAKADEADEEPREDPLARTGIPFGGMIKDMKRRYRHYISDFTDALDPQVLAAVIF
IYFAALSPAITFGGLLADKTEHMMGVSELMISTCVQGIIFAFIAAQPTLVIGFSGPLLVFEEAFFAFCKSQEIEYIVGRI
WVGLWLVIIVVVIVAVEGSFLVKFISRFTQEIFSILISLIFIYETFSKLGKIFKAHPLVLNYEHLNDSLDNPFHPVVKEH
IEYHEDGNKTVHEVIHERAYPNTALLSMCLMFGCFFIAYFLRQFKNGHFLPGPIRRMIGDFGVPIAIFFMIAVDITIEDA
YTQKLVVPKGLMVSNPNARGWFINPLGEKKPFPAWMMGACCVPALLVFILIFLESQITTLIVSKPERKMVKGSGFHLDLL
ILVTMGGIASLFGVPWLSAATVRSVTHANALTVMSKGPKPEIEKVLEQRISGMLVAAMVGVSILLEPILKMIPMTALFGI
FLYMGITSLSGIQMWDRMLLLIVPRKYYPADAYAQRVTTMKMHLFTLIQMVCLGALWMVKMSAFSLALPFVLILTIPLRM
AITGTLFTDKEMKCLDASDGKVKFEEEPGEDMYESPLP