TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P33369|MDTQ_ECOLI Putative multidrug resistance outer membrane protein MdtQ OS=Escherichia coli (strain K12) GN=mdtQ PE=5 SV=2
MNRDSFYPAIACFPLLLMLAGCAPMHETRQALSQQTPAAQVDTALPTALKMVGQTXQWWLEYHDNQLTSLINNALQNAPD
MQVAEQRIQLAEAQAKAVATQDGPQIDFSADMERQKMSAEGLMGPFALNDPAAGTTGPWYTNGTFGLTAGWHLDIWGKNR
AEVTARLGTVKARAAEREQTRQLLAGSVARLYWEWQTQAALNTVLQQIEKEQNTIIATDRQLYQNGITSSVEGVETDINA
SKTRQQLNDVAGKMKIIEARLSALTNNQTKSLKLKPVALPKVASQLPDELGYSLLARRADLQAAHWYVESSLSTIDAAKA
AFYPDINLMAFLQQDALHLSDLFRHSAQQMGVTAGLTLPIFDSGRLNANLDIAKAESNLSIASYNKAVVEAVNDVARAAS
QVQTLAEKNQHQAQIERDALRVVGLAQARFNAGIIAGSRVSEARIPALRERANGLLLQGQWLDASIQLTGALGGGYKR