TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P35818|GSPD_PSEAE GENERAL SECRETION PATHWAY PROTEIN D PRECURSOR - Pseudomonas aeruginosa.
MSQPLLRALFAPSSRSYVPAVLLSLALGIQAAHAENSGGNAFVPAGNQQEAHWTINLKDADIREFIDQISEITGETFVVD
PRVKGQVSVVSKAQLSLSEVYQLFLSVMSTHGFTVVAQGDQARIVPNAEAKTEAGGGQSAPDRLETRVIQVQQSPVSELI
PLIRPLVPQYGHLAAVPSANALIISDRSANIARIEDVIRQLDQKGSHDYSVINLRYGWVMDAAEVLNNAMSRGQAKGAAG
AQVIADARTNRLIILGPPQARAKLVQLAQSLDTPTARSANTRVIRLRHNDAKTLAETLGQISEGMKNNGGQGGEQTGGGR
PSNILIRADESTNALVLLADPDTVNALEDIVRQLDVPRAQVLVEAAIVEISGDIQDAVGVQWAINKGGMGGTKTNFANTG
LSIGTLLQSLESNKAPESIPDGAIVGIGSSSFGALVTALSANTKSNLLSTPSLLTLDNQKAEILVGQNVPFQTGSYTTNS
EGSSNPFTTVERKDIGVSLKVTPHINDGAALRLEIEQEISALLPNAQQRNNTDLITSKRSIKSTILAENGQVIVIGGLIQ
DDVSQAESKVPLLGDIPLLGRLFRSTKDTHTKRNLMVFLRPTVVRDSAGLAALSGKKYSDIRVIDGTRGPEGRPSILPTN
ANQLFDGQAVDLRELMTE