TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P35938|VMT2_IAUSS MATRIX PROTEIN M2 - Influenza A virus (strain A/USSR/90/77).
MSLLTEVETPIRNEWGCRCNDSSDPLVVAASIIGILHLILWILDRLFFKCIYRLFKHGLKRGPSTEGVPESMREEYRKEQ
QNAVDADDSHFVNIELE