TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P36619|PMD1_SCHPO Leptomycin B resistance protein pmd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmd1 PE=3 SV=2
MSLHSKKSTSTVKDNEHSLDLSIKSIPSNEKNFSTEKSENEASESHVVDVVKDPFEQYTPEEQEILYKQINDTPAKLSGY
PRILSYADKWDIMLQLAGTITGIGAGLGMPLMSLVSGQLAQAFTDLASGKGASSFQHTVDHFCLYFIYIAIGVFGCSYIY
TVTFIIAGERIARRIRQDYLHAILSQNIGYFDRLGAGEITTRITTDTNFIQDGLGEKVGLVFFAIATFVSGFVIAFIRHW
KFTLILSSMFPAICGGIGLGVPFITKNTKGQIAVVAESSTFVEEVFSNIRNAFAFGTQDILAKLYNKYLITAQRFGINKA
IAMGLMVGWMFFVAYGVYGLAFWEGGRLLHAGDLDVSKLIGCFFAVLIASYSLANISPKMQSFVSCASAAKKIFDTIDRV
SPINAFTPTGDVVKDIKGEIELKNIRFVYPTRPEVLVLDNFSLVCPSGKITALVGASGSGKSTIIGLVERFYDPIGGQVF
LDGKDLRTLNVASLRNQISLVQQEPVLFATTVFENITYGLPDTIKGTLSKEELERRVYDAAKLANAYDFIMTLPEQFSTN
VGQRGFLMSGGQKQRIAIARAVISDPKILLLDEATSALDSKSEVLVQKALDNASRSRTTIVIAHRLSTIRNADNIVVVNA
GKIVEQGSHNELLDLNGAYARLVEAQKLSGGEKDQEMVEEELEDAPREIPITSFGDDDEDNDMASLEAPMMSHNTDTDTL
NNKLNEKDNVVFEDKTLQHVASEIVPNLPPADVGELNEEPKKSKKSKKNNHEINSLTALWFIHSFVRTMIEIICLLIGIL
ASMICGAAYPVQAAVFARFLNIFTDLSSTDFLHKVNVFAVYWLILAIVQFFAYAISNFAMTYAMEAVLQRIRYHLFRTLL
RQDVEFFDRSENTVGAITTSLSTKIQSLEGLSGPTLGTFFQILTNIISVTILSLATGWKLGLVTLSTSPVIITAGYYRVR
ALDQVQEKLSAAYKESAAFACESTSAIRTVASLNREENVFAEYCDSLIKPGRESAIASLKSGLFFSAAQGVTFLINALTF
WYGSTLMRKGEYNIVQFYTCFIAIVFGIQQAGQFFGYSADVTKAKAAAGEIKYLSESKPKIDTWSTEGKKVESLQSAAIE
FRQVEFSYPTRRHIKVLRGLNLTVKPGQFVAFVGSSGCGKSTTIGLIERFYDCDNGAVLVDGVNVRDYNINDYRKQIALV
SQEPTLYQGTVRENIVLGASKDVSEEEMIEACKKANIHEFILGLPNGYNTLCGQKGSSLSGGQKQRIAIARALIRNPKIL
LLDEATSALDSHSEKVVQEALNAASQGRTTVAIAHRLSSIQDADCIFVFDGGVIAEAGTHAELVKQRGRYYELVVEQGLN
KA