TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P37626|YHII_ECOLI Uncharacterized protein YhiI OS=Escherichia coli (strain K12) GN=yhiI PE=3 SV=1
MDKSKRHLAWWVVGLLAVAAIVAWWLLRPAGVPEGFAVSNGRIEATEVDIASKIAGRIDTILVKEGKFVREGEVLAKMDT
RVLQEQRLEAIAQIKEAQSAVAAAQALLEQRQSETRAAQSLVNQRQAELDSVAKRHTRSRSLAQRGAISAQQLDDDRAAA
ESARAALESAKAQVSASKAAIEAARTNIIQAQTRVEAAQATERRIAADIDDSELKAPRDGRVQYRVAEPGEVLAAGGRVL
NMVDLSDVYMTFFLPTEQAGTLKLGGEARLILDAAPDLRIPATISFVASVAQFTPKTVETSDERLKLMFRVKARIPPELL
QQHLEYVKTGLPGVAWVRVNEELPWPDDLVVRLPQ