TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P38090|AGP2_YEAST General amino acid permease AGP2 - Saccharomyces cerevisiae (Baker's yeast).
MTKERMTIDYENDGDFEYDKNKYKTITTRIKSIEPSEGWLEPSGSVGHINTIPEAGDVHVDEHEDRGSSIDDDSRTYLLY
FTETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASLLLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKC
VDDSLAVMASWNFWFLECVQIPFEIVSVNTIIHYWRDDYSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALG
LFTFTFITMLGGNPEHDRYGFRNYGESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFTIAGGEYISMLAGEVKRPRKVL
PKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINEARPGAGSSPYVIAMNNLKIRILPDIVNIALITAAFSAGNAY
TYCSSRTFYGMALDGYAPKIFTRCNRHGVPIYSVAISLVWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIVYLF
FRRAYHVQQDSLPKLPFRSWGQPYTAIIGLVSCSAMILIQGYTVFFPKLWNTQDFLFSYLMVFINIGIYVGYKFIWKRGK
DHFKNPHEIDFSKELTEIENHEIESSFEKFQYYSKA