TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P38206|RFT1_YEAST Nuclear division RFT1 protein - Saccharomyces cerevisiae (Baker's yeast).
MAKKNSQLPSTSEQILERSTTGATFLMMGQLFTKLVTFILNNLLIRFLSPRIFGITAFLEFIQGTVLFFSRDAIRLSTLR
ISDSGNGIIDDDDEEEYQETHYKSKVLQTAVNFAYIPFWIGFPLSIGLIAWQYRNINAYFITLPFFRWSIFLIWLSIIVE
LLSEPFFIVNQFMLNYAARSRFESIAVTTGCIVNFIVVYAVQQSRYPMGVVTSDIDKEGIAILAFALGKLAHSITLLACY
YWDYLKNFKPKKLFSTRLTKIKTRENNELKKGYPKSTSYFFQNDILQHFKKVYFQLCFKHLLTEGDKLIINSLCTVEEQG
IYALLSNYGSLLTRLLFAPIEESLRLFLARLLSSHNPKNLKLSIEVLVNLTRFYIYLSLMIIVFGPANSSFLLQFLIGSK
WSTTSVLDTIRVYCFYIPFLSLNGIFEAFFQSVATGDQILKHSYFMMAFSGIFLLNSWLLIEKLKLSIEGLILSNIINMV
LRILYCGVFLNKFHRELFTDSSFFFNFKDFKTVIIAGSTICLLDWWFIGYVKNLQQFVVNVLFAMGLLALILVKERQTIQ
SFINKRAVSNSKDV