TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P38370|OAR_MYXXA Protein oar OS=Myxococcus xanthus GN=oar PE=1 SV=1
MHLNRVLRETGVVVAAGLLYGSAAFAQSSTIIGTVIDAQSRQPAADVVVTATSPNLQGEQTVVTDAQGNYRIPQLPPGDY
TLRFEKEQFKPYARSAIQLRLNRTIRVNVELLPEALGEVVEIVGAPPTIDVGSTTMGVNVDQEFIKRIAVARPGGKGGAT
RSFESLAELAPGAQNDNYGVSINGSTSPENGYVVDGLSTNDPAFGVNASPLSIEFVQDVNIITGGYMPEFGRSTGGVINA
VTRSGSNEFHGSVFANWTPGTLEGTRKQIREEGTVITGQNQLQNLGDFGATLGGPILKDKLWFFAGFAPSFTRYQHTRTL
NALRVDDEGNTIKDETDFTVADAIPGSARKYYADSRTIQYMGKLTYLINQDHNVSFALNGTPTSTGGLGKLSVNPQSGGL
PGVLATRPGDFGLTETKANTTSLALKYAGAFADKKVLVDANLGWFHQTASTLPGDGSNLGDRTGLAGYSRMVYTTPRALT
LFEALPEGQEGACGSTPEEQLVRSPVTGYGVGGPGFMSDQTLDRYQANAKATYLLNALGTHVFKAGVDVELLSFDQVKAY
GGGVFFQEGSNYGVAGQGPAVHDARRYGYQTGPDSAVTQFTQVAKTTSTTVGGFLQDSWSIANRVTLNLGVRYDVQALYG
GNGDLSLLLGNQWSPRIGAIVDPFANGRAKVFVNFARYYEQVPLNLMDRAFPGENRISARRSLAEPGQGTATSCDPSSFE
SQQATCNTDSNLLAIPESSRNVNRFYTGGTVGGTPVDPDIKAQSSDEIVVGAEYEVLANTRLGASYTHKDMNSVIEDMSR
DDGNTYFLGNPGSGFAGEFPTPVRNYDNVTVYLNRTFADGWLAQANYTWSRLYGNYPGLFRPETGQLDPNILSDFDLIEL
LENRTGLLPFDRTHQIKVFGAKEFNISNALSASVGVSYRGSSGTPINYWGSHWAYLQDESFVLPRGAGGRTPWINTIDSN
IGVNYRVSKDSVVSFTLDVFNLFNFQGVNTVDQTYTLRDIKPIPGGTPADLENLPGRVEFQDQAPRDEPFGSVDGDVNKN
FKNPLSYQAPRQVRFGIRYTF