TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P38921|PET8_YEAST Putative mitochondrial carrier protein PET8 - Saccharomyces cerevisiae (Baker's yeast).
MNTFFLSLLSGAAAGTSTDLVFFPIDTIKTRLQAKGGFFANGGYKGIYRGLGSAVVASAPGASLFFISYDYMKVKSRPYI
SKLYSQGSEQLIDTTTHMLSSSIGEICACLVRVPAEVVKQRTQVHSTNSSWQTLQSILRNDNKEGLRKNLYRGWSTTIMR
EIPFTCIQFPLYEYLKKTWAKANGQSQVEPWKGAICGSIAGGIAAATTTPLDFLKTRLMLNKTTASLGSVIIRIYREEGP
AVFFSGVGPRTMWISAGGAIFLGMYETVHSLLSKSFPTAGEMRA