TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P39285|YJEP_ECOLI Uncharacterized mscS family protein yjeP OS=Escherichia coli (strain K12) GN=yjeP PE=3 SV=3
MRLIITFLMAWCLSWGAYAATAPDSKQITQELEQAKAAKPAQPEVVEALQSALNALEERKGSLERIKQYQQVIDNYPKLS
ATLRAQLNNMRDEPRSVSPGMSTDALNQEILQVSSQLLDKSRQAQQEQERAREIADSLNQLPQQQTDARRQLNEIERRLG
TLTGNTPLNQAQNFALQSDSARLKALVDELELAQLSANNRQELARLRSELAEKESQQLDAYLQALRNQLNSQRQLEAERA
LESTELLAENSADLPKDIVAQFKINRELSAALNQQAQRMDLVASQQRQAASQTLQVRQALNTLREQSQWLGSSNLLGEAL
RAQVARLPEMPKPQQLDTEMAQLRVQRLRYEDLLNKQPLLRQIHQADGQPLTAEQNRILEAQLRTQRELLNSLLQGGDTL
LLELTKLKVSNGQLEDALKEVNEATHRYLFWTSDVRPMTIAWPLEIAQDLRRLISLDTFSQLGKASVMMLTSKETILPLF
GALILVGCSIYSRRYFTRFLERSAAKVGKVTQDHFWLTLRTLFWSILVASPLPVLWMTLGYGLREAWPYPLAVAIGDGVT
ATVPLLWVVMICATFARPNGLFIAHFGWPRERVSRGMRYYLMSIGLIVPLIMALMMFDNLDDREFSGSLGRLCFILICGA
LAVVTLSLKKAGIPLYLNKEGSGDNITNHMLWNMMIGAPLVAILASAVGYLATAQALLARLETSVAIWFLLLVVYHVIRR
WMLIQRRRLAFDRAKHRRAEMLAQRARGEEEAHHHSSPEGAIEVDESEVDLDAISAQSLRLVRSILMLIALLSVIVLWSE
IHSAFGFLENISLWDVTSTVQGVESLEPITLGAVLIAILVFIITTQLVRNLPALLELAILQHLDLTPGTGYAITTITKYL
LMLIGGLVGFSMIGIEWSKLQWLVAALGVGLGFGLQEIFANFISGLIILFEKPIRIGDTVTIRDLTGSVTKINTRATTIS
DWDRKEIIVPNKAFITEQFINWSLSDSVTRVVLTIPAPADANSEEVTEILLTAARRCSLVIDNPAPEVFLVDLQQGIQIF
ELRIYAAEMGHRMPLRHEIHQLILAGFHAHGIDMPFPPFQMRLESLNGKQTGRTLTSAGKGRQAGSL