TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P39456|YCKI_BACSU Probable amino-acid ABC transporter ATP-binding protein yckI - Bacillus subtilis.
MLTVKGLNKSFGENEILKKIDMKIEKGKVIAILGPSGSGKTTLLRCLNALEIPNRGELAFDDFSIDFSKKVKQADILKLR
RKSGMVFQAYHLFPHRTALENVMEGPVQVQKRNKEEVRKEAIQLLDKVGLKDKMDLYPFQLSGGQQQRVGIARALAIQPE
LMLFDEPTSALDPELVGEVLKVIKDLANEGWTMVVVTHEIKFAQEVADEVIFIDGGVIVEQGPPEQIFSAPKEERTQRFL
NRILNPL