TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P41909|PXA1_YEAST Peroxisomal long-chain fatty acid import protein 2 OS=Saccharomyces cerevisiae GN=PXA1 PE=1 SV=2
MSTTLAAPAKLKSLLLNLHTHCIGLHVNDVTPKVYFKLLIRHLLQISRSNAAHPKLRRRAQILLVSLFLSGVTLFSGVTY
STFKIILKCYKFYKFPWKRRNRRPLIRRTRSQMQLDSGARIMYIPEVELVDRQSPDDNKFMNATDKKKRKRIFIPPKDND
VYEHDKFLFKNVELERAKNSQLFYSKFLNQMNVLSKILIPTVFDKNFLLLTAQIFFLVMRTWLSLFVAKLDGQIVKNIIA
GRGRSFLWDLGCWFLIAVPASYTNSAIKLLQRKLSLNFRVNLTRYIHDMYLDKRLTFYKLIFDAKASNSVIKNIDNSITN
DVAKFCDATCSVFANIAKPVIDLIFFSVYLRDNLGTVGVAGIFVNYFITGFILRKYTPPLGKLAGERSASDGDYYNYHLN
MINNSEEIAFYQGTAVERTKVKELYDVLMEKMLLVDKVKFGYNMLEDYVLKYTWSGLGYVFASIPIVMSTLATGINSEEK
NMKEFIVNKRLMLSLADAGSRLMHSIKDISQLTGYTNRIFTLLSVLHRVHSLNFNYGAVPSILSIRTEDASRNSNLLPTT
DNSQDAIRGTIQRNFNGIRLENIDVIIPSVRASEGIKLINKLTFQIPLHIDPITSKSNSIQDLSKANDIKLPFLQGSGSS
LLILGPNGCGKSSIQRIIAEIWPVYNKNGLLSIPSENNIFFIPQKPYFSRGGTLRDQIIYPMSSDEFFDRGFRDKELVQI
LVEVKLDYLLKRGVGLTYLDAIADWKDLLSGGEKQRVNFARIMFHKPLYVVLDEATNAISVDMEDYLFNLLKRYRFNFIS
ISQRPTLIKYHEMLLEIGENRDGKWQLQAVGTDEAITSIDNEIEELERKLERVKGWEDERTKLREKLEII