TCDB is operated by the Saier Lab Bioinformatics Group
>P42063|APPC_BACSU Oligopeptide transport system permease protein appC - Bacillus subtilis.
MSELQTTPSPEIRLKENISKKPETMTKIFWEKFSKNKLAILGAVILFIIIMSAVFAPLIAPYPQEQQSLLDKYKAPGLEH
LMGTDKFGRDIFSRILYGARVSLLVGFASVVGSILIGTVLGALAGYFRGIVDAVIMRVVDIVLSIPDIFLLITLVTIFKP
GVDKLILIFCLTGWTTTARLVRGEFLSLRSREYVLAAKTIGTKTHKIIFSHILPNALGPIIVSATLKVGSVILAESALSY
LGFGIQPPIASWGNMLQDAQNFTVMIQAWWYPLFPGLFILMTVLCFNFVGDGLRDALDPKNIK