TCDB is operated by the Saier Lab Bioinformatics Group
>P42333|BCRB_BACLI Bacitracin transport permease protein BCRB - Bacillus licheniformis.
MAKKAKYPDVPIRFSETFSDTNLYIVLLIGVPLYGVITSYLFNREYAESTLKNLLTIPVSRISLIVSKLVLLLIWIMMLT
LIAWVLTLLFGLIGQFEGLSSAVLIEGFKQFMIGGALLFFLVSPIIFVTLLFKNYVPTIIFTIIISMVSIMVYGTEYSAL
FPWSAVWVIASGTFFPEYPPEYSFISVAATTVLGLAATIVYFKKIDIH