TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P42423|YXDL_BACSU ABC transporter ATP-binding protein yxdL OS=Bacillus subtilis GN=yxdL PE=2 SV=2
MANMLEVKHINKTYKGQVSYQALKQISFSIEEGEFTAVMGPSGSGKTTLLNIISTIDRPDSGDILINGENPHRLKRTKLA
HFRRKQLGFVFQDFNLLDTLTIGENIMLPLTLEKEAPSVMEEKLHGIAAKLGIENLLNKRTFEVSGGQRQRAAIARAVIH
KPSLILADEPTGNLDSKATKDVMETLQSLNRDDHVTALMVTHDPVSASYCRRVIFIKDGELFNEIYRGENRQVFYEQILD
VLSMLGGNANDLSSVRL