TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P42424|YXDM_BACSU ABC transporter permease protein yxdM OS=Bacillus subtilis GN=yxdM PE=2 SV=3
MTFLQFAYKNVTRNKRAYLAFFLSSAFSVLIFFTFAMFLFHPALKEGYLNNIAKKGLTAAEWMIFVFSFLFVLYSVNAFL
KSRNKEFGILLMQGITPGQLRKLITAENMIIGVMSIAAGIIGGFIFSKTFFTVGAYILEMDALPLYMPWKALGITACGFL
LLFFFLSQFTILFVRSNTVIKLIKGTGKVKPEPKPSVLLSLFGIACLCGGYGMVLKGNVHGAEPFIILLLTVIGTYFFFS
QSSIWILRALKKWKTFYLRGKNIIWVSDLVYRLKDNARLFFIVSIISAVAFTATGVLAMYKSTVGAEESAYEMEYLSYSN
NPKEQTHLKDIDHELKTHGFTYTKDKIDVSYVRYQEGETVPPVYMISESDAAKYFHVKVNGLKEDEAVYFPGTYDRNFKN
EAPDQLKLLNQKGELSDQKLSVKEVKKPLISLNAIIAVNDQTFDQLKSLGDKASLYGYSYDHWKDSLEISQSLQNEIYGN
YIDVHSDFASKAGTYYDTVQLPSLSLFIGLFIAIVFFVAAASFLYFRLFTDLDEDRERYRSLAKIGLSEREMAQSVTIQL
AILFFFPFVIAVMHTLFALRTLAVEGYSDVAGPLSLTIGGFFIFQLLFFLAVRSSYLKKMNK