TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P42953|TAGG_BACSU Teichoic acid translocation permease protein TAGG - Bacillus subtilis.
MNDLLRILREQITSFPLILRLAAYETKSKYQMNYLGVLWQFLNPLIQMLAYWFVFGMGIRKGGPVTTGAGEVPFIIWMLA
GLIPWFFISPTILDGSNSVFKRINMVAKMNFPISSLPSVAIASNLFSYMIMMVIYIIVLLVNGVFPSVHWLQYIYYFICM
IAFMFSFSLFNSTISVLIRDYQFLLQAVTRLLFFLLPIFWDVNAKLGQSHPELVPVLKLNPLFYIIEGFRNSFLDGAWFF
HDMKYTLYFWLFTFLLLLVGSILHMKFRDKFVDFL