TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P43125|RDGB_DROME Protein retinal degeneration B OS=Drosophila melanogaster OX=7227 GN=rdgB PE=1 SV=2
MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYKDGPGGNGQYTKKIYHVGNHLPGWIKSLLPKS
ALTVEEEAWNAYPYTRTRYTCPFVEKFSLDIETYYYPDNGYQDNVFQLSGSDLRNRIVDVIDIVKDQLWGGDYVKEEDPK
HFVSDKTGRGPLAEDWLEEYWREVKGKKQPTPRNMSLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAW
QDEWFGLTIEDIRELERQTQLALAKKMGGGEECSDDSVSEPYVSTAATAASTTGSERKKSAPAVPPIVTQQPPSAEASSD
EEGEEEEDDDEDENDAIGTGVDLSANQGGSAQRSRSQSIQMAQKGKFGSKGALHSPVGSAHSFDLQVANWRMERLEVDSK
SNSDEEFFDCLDTNETNSLAKWSSLELLGEGDDSPPPHGGPSSAASVGGRGNSRQEDSIFNQDFLMRVASERGNKRQLRS
SASVDRSHDSSPPGSPSTPSCPTTILILVVHAGSVLDAASELTAKKSDVTTFRGSFEAVMRQHYPSLLTHVTIKMVPCPS
ICTDALGILSSLSPYSFDASPSAADIPNIADVPIGAIPLLSVASPEFHETVNKTVAAANIVYHEFLKSEEGHGFSGQIVM
LGDSMGSLLAYEALCRSNGSQPGTASGASNSGGDAATNINTHNPLSPRNSRLDDDERFIEADLDAKRLLVAPSPRRRRSS
SSSDSRATKLDFEVCDFFMFGSPLSVVLAARKLHDAKAALPRPNCHQVYNLFHPTDPIASRLEPLLSARFSILAPVNVPR
YAKYPLGNGQPLHLLEVIQSHPQHFNDGNNLLAGRRLSDASMQSTISGLIENVSLSTIHALQNKWWGTKRLDYALYCPEG
LSNFPAHALPHLFHASYWESPDVIAFILRQIGKFEGIPFVGSNDDKDNASFHPGQPREKWIKKRTSVKLKNVAANHRAND
VIVQEGREQRLNARFMYGPLDMITLHGEKVDVHIMKDPPAGEWTFLSTEVTDKNGRISYSIPDQVSLGYGIYPVKMVVRG
DHTSVDCYMAVVPPLTECVVFSIDGSFTASMSVTGRDPKVRAGAVDVCRHWQELGYLLIYITGRPDMQQQRVVSWLSQHN
FPHGLISFADGLSTDPLGHKTAYLNNLVQNHGISITAAYGSSKDISVYTNVGMRTDQIFIVGKVGKKLQSNATVLSDGYA
AHLAGLQAVGGSRPAKGNARMVIPRGCFNLPGQTANPRRRRYLERKTVSSCCLMVFQTT