TCDB is operated by the Saier Lab Bioinformatics Group
>P43505|MTRC_NEIGO Membrane fusion protein mtrC - Neisseria gonorrhoeae.
MAFYASKAMRAAALAAAVALALSSCGKGGDAAQGGQPAGREAPAPVVGVVTVHPQTVALTVELPGRLESLRTADVRAQVG
GIIQKRLFQEGSYVRAGQPLYQIDSSTYEAGLESARAQLATAQATLAKADADLARYKPLVSADAISKQEYDAAVTAKRSA
EASVKAAQAAIKSAGINLNRSRITAPISGFIGQSKVSEGTLLNAGDTTVLATIRQTNPMYVNVTQSASEVMKLRRQIAEG
KLLAADGAIAVGIKFDDGTVYPEKGRLLFADPTVDESTGQITLRAAVSNDQNILMPGLYVRVLMDQVAADNAFIVPQQAV
TRGAKDTVMIVNAQGGMEPREVTVAQQQGTNWIVTSGLKDGDKVVVEGISIAGMTGAKKVTPKEWAPSENQAAAPQAGVQ
TASEAKPASEAK