TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P44970|TBPA_HAEIN Probable transferrin-binding protein 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=tbpA PE=3 SV=1
MTKKPYFRLSIISCLLISCYVKAETQSIKDTKEAISSEVDTQSTEDSELETISVTAEKVRDRKDNEVTGLGKIIKTSESI
SREQVLNIRDLTRYDPGISVVEQGRGASSGYSIRGMDRNRVALLVDGLPQTQSYVVQSPLVARSGYSGTGAINEIEYENV
KAVEISKGGSSSEYGNGALAGSVTFQSKSAADILEGDKSWGIQTKNAYSSKNKGFTHSLAVAGKQGGFEGLAIYTQRNSI
ETQVHKDALKGVQSYNRLIAKPENQSAYFVMEDECPKGYDECIPSAKPPAILSTKKETVSVSDYTGANRIKPNPMKYESQ
SWFLRGGYHFSEQHYIGGIFEFTQQKFDIRDMTFPAYLSPTEKGDLANRPFYPKQDYGAYQHIEDGRGVKYASGLYFDEH
HRKQRVGIEYIYENKNKAGIIDKAVLSANQQNIILDSYMRHTHCSLYPNPSKNCRPTLDKPYSYYRSDRNVYKEKHNMLQ
LNLEKKIQQNWLTHQIVFNLGFDDFTSALQHKDYLTRRVIATADSISDKTGKTRRNGLREYPYLYPKPKPYFAGEDHCNY
QGSSSNYRDCKVRLIKGKNYYFAARNNMALGKYVDLGLGIRYDVSRTKANESTISVGKFKNFSWNTGIVIKPTEWLDLSY
RLSTGFRNPSFAEMYGWRYGGKNDEVYVGKFKPETSRNQEFGLALKGDFGNIEISHFSNAYRNLIAFAEELSKNGTGKGN
YGYHNAQNAKLVGVNITAQLDFNGLWKRIPYGWYATFAYNRVKVKDQKINAGLASVSSYLFDAIQPSRYIIGLGYDHISN
TWGVNATFTQSKAKSQNELLGKRALGNNSRDVKSTRKLTRAWHILDVSGYYMANKNIMLRLGIYNLFNYRYVTWEAVRQT
AQGAVNQHQNVGNYTRYAASGRNYTLTLEMKF