TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P45096|DPPB_HAEIN Dipeptide transport system permease protein dppB OS=Haemophilus influenzae GN=dppB PE=3 SV=1
MFKFVFKRILMVIPTFIAITLITFALVHFIPGDPVEIMMGERGLTAEVHQQMMHQLGLDLPLYQQYFHYIGNVIQGDFGA
SFRTQQPVLTEFFTLFPATAELAFFALFWSLLGGIILGTIAAVKKDSWISHTVTAASLTGYSMPIFWWGLILILYVSPQL
GLPQGGRLDNEFWIDTPTGFMLIDSWLSGVSGAFENAVKSLILPAIVLGTVPLAIITRMTRSAMLEVLGEDYIRTAKAKG
LSYTRIVIVHALRNALIPVVTVVGLIVAQLLSGAVLTETIFSWPGIGKWIIDAIQARDYPVLQGSVLIIATIIIVVNLTV
DLLYGVVNPRIRH