TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P45387|HAP_HAEIN ADHESION AND PENETRATION PROTEIN PRECURSOR (EC 3.4.21.-) - Haemophilus influenzae.
MKKTVFRLNFLTACISLGIVSQAWAGHTYFGIDYQYYRDFAENKGKFTVGAQNIKVYNKQGQLVGTSMTKAPMIDFSVVS
RNGVAALVENQYIVSVAHNVGYTDVDFGAEGNNPDQHRFTYKIVKRNNYKKDNLHPYEDDYHNPRLHKFVTEAAPIDMTS
NMNGSTYSDRTKYPERVRIGSGRQFWRNDQDKGDQVAGAYHYLTAGNTHNQRGAGNGYSYLGGDVRKAGEYGPLPIAGSK
GDSGSPMFIYDAEKQKWLINGILREGNPFEGKENGFQLVRKSYFDEIFERDLHTSLYTRAGNGVYTISGNDNGQGSITQK
SGIPSEIKITLANMSLPLKEKDKVHNPRYDGPNIYSPRLNNGETLYFMDQKQGSLIFASDINQGAGGLYFEGNFTVSPNS
NQTWQGAGIHVSENSTVTWKVNGVEHDRLSKIGKGTLHVQAKGENKGSISVGDGKVILEQQADDQGNKQAFSEIGLVSGR
GTVQLNDDKQFDTDKFYFGFRGGRLDLNGHSLTFKRIQNTDEGAMIVNHNTTQAANVTITGNESIVLPNGNNINKLDYRK
EIAYNGWFGETDKNKHNGRLNLIYKPTTEDRTLLLSGGTNLKGDITQTKGKLFFSGRPTPHAYNHLNKRWSEMEGIPQGE
IVWDHDWINRTFKAENFQIKGGSAVVSRNVSSIEGNWTVSNNANATFGVVPNQQNTICTRSDWTGLTTCQKVDLTDTKVI
NSIPKTQINGSINLTDNATANVKGLAKLNGNVTLTNHSQFTLSNNATQIGNIRLSDNSTATVDNANLNGNVHLTDSAQFS
LKNSHFSHQIQGDKGTTVTLENATWTMPSDTTLQNLTLNNSTITLNSAYSASSNNTPRRRSLETETTPTSAEHRFNTLTV
NGKLSGQGTFQFTSSLFGYKSDKLKLSNDAEGDYILSVRNTGKEPETLEQLTLVESKDNQPLSDKLKFTLENDHVDAGAL
RYKLVKNDGEFRLHNPIKEQELHNDLVRAEQAERTLEAKQVEPTAKTQTGEPKVRSRRAARAAFPDTLPDQSLLNALEAK
QAELTAETQKSKAKTKKVRSKRAVFSDPLLDQSLFALEAALEVIDAPQQSEKDRLAQEEAEKQRKQKDLISRYSNSALSE
LSATVNSMLSVQDELDRLFVDQAQSAVWTNIAQDKRRYDSDAFRAYQQQKTNLRQIGVQKALANGRIGAVFSHSRSDNTF
DEQVKNHATLTMMSGFAQYQWGDLQFGVNVGTGISASKMAEEQSRKIHRKAINYGVNASYQFRLGQLGIQPYFGVNRYFI
ERENYQSEEVRVKTPSLAFNRYNAGIRVDYTFTPTDNISVKPYFFVNYVDVSNANVQTTVNLTVLQQPFGRYWQKEVGLK
AEILHFQISAFISKSQGSQLGKQQNVGVKLGYRW