TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P45394|YRBG_ECOLI HYPOTHETICAL 34.7 KDA PROTEIN IN MURA-RPON INTERGENIC REGION (O325) - Escherichia coli.
MLLATALLIVGLLLVVYSADRLVFAASILCRTFGIPPLIIGMTVVSIGTSLPEVIVSLAASLHEQRDLAVGTALGSNIIN
ILLILGLAALVRPFTVHSDVLRRELPLMLLVSVVAGSVLYDGQLSRSDGIFLLFLAVLWLLFIVKLARQAERQGTDSLTR
EQLAELPRDGGLPVAFLWLGIALIIMPVATRMVVDNATVLANYFAISELTMGLTAIAIGTSLPELATAIAGVRKGENDIA
VGNIIGANIFNIVIVLGLPALITPGEIDPLAYSRDYSVMLLVSIIFALLCWRRSPQPGRGVGVLLTGGFIVWLAMLYWLS
PILVE