TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P45564|YFEN_ECOLI Uncharacterized protein YfeN OS=Escherichia coli (strain K12) GN=yfeN PE=4 SV=1
MKKHLLTLTLSSILAIPVVSHAEFKGGFADIGVHYLDWTSRTTEKSSTKSHKDDFGYLEFEGGANFSWGEMYGFFDWENF
YNGRHNKPGSEQRYTFKNTNRIYLGDTGFNLYLHAYGTYGSANRVNFHDDMFLYGIGYNFTGSGWWFKPFFAKRYTDQTY
YTGDNGYVAGWVAGYNFMLGSEKFTLTNWNEYEFDRDATYAAGNGGKEGLNGAVALWWNATSHITTGIQYRYADDKLGED
FYQDAIIYSIKFNF