TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P45706|CCDA_BACSU CYTOCHROME C-TYPE BIOGENESIS PROTEIN CCDA - Bacillus subtilis.
MGDVNYFLTFGAGFLSFISPCCLPLYPAFLSYITGVSMDDVKTEKLLLQKRSLFHTLCFLLGFSVIFIALGYGTSFIGSL
FRDYHDAIRQIGALLIILFGFITLGVFRPEAMMKERRIHFKHKPSGFLGSVLIGMAFAAGWTPCTGPILAAVITLAGTNP
GSAVPYMMLYVLGFAVPFLLLSFFITKLKWIRKNQLFIMKAGGVLMIVIGVLLFFNWMSLIIILLSDLFGGFTGF