TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P46920|OPAA_BACSU Glycine betaine transport ATP-binding protein opuAA - Bacillus subtilis.
MSVDEKPIKIKVEKVSKIFGKQTKKAVQMLANGKTKKEILKATGSTVGVNQADFEVYDGEIFVIMGLSGSGKSTLVRMLN
RLIEPTAGNIYIDGDMITNMSKDQLREVRRKKISMVFQKFALFPHRTILENTEYGLELQGVDKQERQQKALESLKLVGLE
GFEHQYPDQLSGGMQQRVGLARALTNDPDILLMDEAFSALDPLIRKDMQDELLDLHDNVGKTIIFITHDLDEALRIGDRI
VLMKDGNIVQIGTPEEILMNPSNEYVEKFVEDVDLSKVLTAGHIMKRAETVRIDKGPRVALTLMKNLGISSIYAVDKQKK
LLGVIYASDAKKAAESDLSLQDILNTEFTTVPENTYLTEIFDVVSDANIPIAVVDEKQRMKGIVVRGALIGALAGNNEYI
NAEGTNEQTQDPSAQEVK