TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P46921|OPAB_BACSU Glycine betaine transport system permease protein opuAB - Bacillus subtilis.
MDRLPRIPLADIIDRFVDWITMTFGGFFDGIANGLAAFVNGIVTGLGFIPSILLTIIFAALAWWISTRGIALFTLIGFLL
IDYLGYWDPMLQTLALVLTSVIISIVVGVPIGIWASQKETVRRIVTPILDLMQTMPAFVYLLPAIFFFNIGVVPGVVASV
IFAMPPTIRMTVLGIKQVPADLIEATEAFGSTTAQRLFKVQLPLATKTILAGINQSIMLALSMVVIAAMVGAPGLGSEVY
SAVTQLKTGVGVEAGIAIVIVAITLDRITQNIKVKKKSRGNA