TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P47040|BTN1_YEAST Protein BTN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHC3 PE=2 SV=1
MSDKSHQIYCYFWLFGLINNVLYVVILSAAVDIVGPTLPKSLVLLADIFPSLAIKLCSPFFIDRIKYSYRIWSLITMSCL
GMFLVSFKNLFVCLLGISFASISSGFGEVTFLQLTHYYKQISLNGWSSGTGGAGIIGGASYMFLTSIFKVPVKLTLLVFS
LLPFAFLFYFKLESNDTNLTYQSLQQIDEAEDDQLVPFPVAFTHTNASQSLYSTRQHILQTVKRLRRLVFPYMVPLTTVY
LFEYLINQAVAPTLLFPINGDERSKSMPFFFHKYRDIYVTYGTLYQLGVFISRSFGHLMRMRSLYILAFLQGVNLCITVL
QSWFYVTHSPWAVMILIFYEGFLGGASYVNTFLNILEQEDPDETEFAMGAVSIADSFGVFLAALLGLGLEPKLCRHQIAD
DRPWCRME