TCDB is operated by the Saier Lab Bioinformatics Group
>P47140|AIM25_YEAST Altered inheritance of mitochondria protein 25 - Saccharomyces cerevisiae (Baker's yeast).
MHRTAIFLTYRSCMRNFSTLSKTLTVSSGKVIRNGPFRRVIREKNQITKAPSVKAFKENSNSGIIKVHDPIATTILNEPT
VIIERQIEFMNVFLGFEQANRYAIMDVNGNKIASMMERDFSITKAIMRQFYRLHRPFLVDVFDNWGNVIMTIKRPFSFIN
SHIKTIIPPSAYVDNGSDSTHYHDGKEGTTVGETIQNWHLWRRRYELFQKDGVEGSTFDQFGKIDAPFLSFDFPVTDADG
KIMASVDRNWVGLGREMFTDTGVYVVRFDSQRCFDNIYPTEMLSSQVLTLDQRAVLLANAVSIDFDYFSRHSRQTGGFLS
FGGGYDE