TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P47467|Y225_MYCGE Uncharacterized protein MG225 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG225 PE=4 SV=1
MGQINRKFSEKQFLLFVVNYIAGFGFIATAISLFRLGPFSWLIFLLVSLVSLIVTLSFARLSSIDSQNYGGPYLWAKKAV
DKEKIAGRMFSFFTGWNNFIIGPLSAATAPLFILNSFSGIDGIRGNLVNTWILIAIGFSFYVLLAFISTKGTSLNKKLIA
LFASVKWIVILSALIVAIYVIARDGNGYSQNNNLESGFFGRREISFAQIATVFITFFYSYAGVEDISVMTPDVKTNNFRK
ILIVSFIAVFLFYFIGIIILNGLQNIAQRGGEANSIGNVADIFKKAAGLGTLIFYGVGALFNNVSTRLSTIIANSRKILP
LAYDNYLPSFFYKQNKKGEFQNAIWFTFGTTLIAMTLLVFIPLVASNFDFDNATEYAASVGSAATLLQYIFVFFIIFKFI
YKKEPLYQKKWVKTTEELLFCLGTIVIVLMLLVYLFPVIDGFSKWETKHTLTIVLYGVLSLIGLVLFLLQEYKHKNKQNA
NKQTTQTTV