TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P48349|14336_ARATH 14-3-3-like protein GF14 lambda OS=Arabidopsis thaliana GN=GRF6 PE=1 SV=1
MAATLGRDQYVYMAKLAEQAERYEEMVQFMEQLVTGATPAEELTVEERNLLSVAYKNVIGSLRAAWRIVSSIEQKEESRK
NDEHVSLVKDYRSKVESELSSVCSGILKLLDSHLIPSAGASESKVFYLKMKGDYHRYMAEFKSGDERKTAAEDTMLAYKA
AQDIAAADMAPTHPIRLGLALNFSVFYYEILNSSDKACNMAKQAFEEAIAELDTLGEESYKDSTLIMQLLRDNLTLWTSD
MQEQMDEA