TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P48994|TRPL_DROME Transient-receptor-potential-like protein OS=Drosophila melanogaster GN=trpl PE=1 SV=2
MGRKKKLPTGVSSGVSHASSAPKSVGGCCVPLGLPQPLLLEEKKFLLAVERGDMPNVRRILQKALRHQHININCMDPLGR
RALTLAIDNENLEMVELLVVMGVETKDALLHAINAEFVEAVELLLEHEELIYKEGEPYSWQKVDINTAMFAPDITPLMLA
AHKNNFEILRILLDRGAAVPVPHDIRCGCEECVRLTAEDSLRHSLSRVNIYRALCSPSLICLTSNDPIITAFQLSWELRN
LALTEQECKSEYMDLRRQCQKFAVDLLDQTRTSNELAIILNYDPQMSSYEPGDRMSLTRLVQAISYKQKKFVAHSNIQQL
LSSIWYDGLPGFRRKSIVDKVICIAQVAVLFPLYCLIYMCAPNCRTGQLMRKPFMKFLIHASSYLFFLFILILVSQRADD
DFVRIFGTTRMKKELAEQELRQRGQTPSKLELIVVMYVIGFVWEEVQEIFAVGMKSYLRNMWNFIDFLRNSLYVSVMCLR
AFAYIQQATEIARDPQMAYIPREKWHDFDPQLIAEGLFAAANVFSALKLVHLFSINPHLGPLQISLGRMVIDIVKFFFIY
TLVLFAFACGLNQLLWYFAALEKSKCYVLPGGEADWGSHGDSCMKWRRFGNLFESSQSLFWASFGMVGLDDFELSGIKSY
TRFWGLLMFGSYSVINVIVLLNLLIAMMSNSYAMIDEHSDTEWKFARTKLWMSYFEDSATLPPPFNVLPSVKWVIRIFRK
SSKTIDRQRSKKRKEQEQFSEYDNIMRSLVWRYVAAMHRKFENNPVSEDDINEVKSEINTMRYEMLEIFENSGMDVSSAN
KKERQPRPRRIKVWERRLMKGFQVAPVQNGCELDAFGNVNGQGEMQEIKVESIPSKPAKETAKERFQRVARTVLLQSTTH
KWNVVLRAAKDSQIGRCTKNERKSLQNLGRAIEEAKRLIMLNPGCPSGRESPIRIEFEDEKTSTLLELLNQISAEISDSE
KPKIRPIWRPPLKTVPARAMAANNTRSLTAPELKISRKSSPAPTPTPTPGVSHTALSQFRNRELPLCPSKLIANSAPSAP
TAPPKKSAPTAPTPTYKPTTHAPFSVEGGNRENTRASDGVRSDNSNFDIHVVDLDEKGGHLGRDNVSDISSIASTSPQRP
KHRN