TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P49755|TMEDA_HUMAN Transmembrane emp24 domain-containing protein 10 OS=Homo sapiens OX=9606 GN=TMED10 PE=1 SV=2
MSGLSGPPARRGPFPLALLLLFLLGPRLVLAISFHLPINSRKCLREEIHKDLLVTGAYEISDQSGGAGGLRSHLKITDSA
GHILYSKEDATKGKFAFTTEDYDMFEVCFESKGTGRIPDQLVILDMKHGVEAKNYEEIAKVEKLKPLEVELRRLEDLSES
IVNDFAYMKKREEEMRDTNESTNTRVLYFSIFSMFCLIGLATWQVFYLRRFFKAKKLIE