TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P50333|NODJ_RHIGA Nodulation protein J - Rhizobium galegae.
MGRVSTEALPSGLLNWVAVWRRNFLAWKKVAPASLLGNLADPMIYIFGLGSGLGVMLGNVGGVSYSAFLAAGMVATSAMT
ASTFETIYATFARMRDHRTWEAMLYTKLTLGDIVLGEMAWAATKASLAGTAIGIVTATLAYSEWDSLIYVFPVIALTGLA
FASLSMVVAALAPSYDYLVFYQSLVITPMLVLSGSVFPVEQLSPMLQRITHLLPLAHSIDLIRPAMLGHPVPDITLHLGA
LCLYIVLPFFVSIALLRRRLTQ