TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P51002|OMPK_VIBPA OUTER MEMBRANE PROTEIN OMPK PRECURSOR - Vibrio parahaemolyticus.
MRKSLLALSLLAATSAPVLAADYSDGDIHKNDYKWMQFNLMGAFNELPGFPDGSNHDYLEMEFGGRSGIFDLYGYVDVFN
LASDPGSDKSGKEKIFMKFAPRMSLDAVTGKDLSFGPVQELYVSTLMEWGGASEVNSQKIGLGSDVMVPWLGKIGLNLYG
TYDSNKKDWNGYQISTNWFKPFYFFENGSFISYQGYIDWQFGMKDEYSSSSYGGAMFNGIYWHSDRFAVGYGLKGYKNIY
GIKEVNGVDSTGFGHYIAVTYKF