TCDB is operated by the Saier Lab Bioinformatics Group
>P52059|YPI3_VIBAL Hypothetical protein in proC 3'region - Vibrio alginolyticus.
MNSMSFLISTLFDLYIMVVILRIWLQAARADFYNPFSQFIVKATQPVIGPLRRIIPSVGNIDLATVLFAYVLCVLKFVVL
ILIASNGSVSFSADFLFLGLLSLIKAAGGLLFWVLLIRAILSWVSQGRSPIEYVFHQLTEPMCAPIRRIIPAIGGLDLSV
LVLFIGLQFANFLMGDIIGPIWFQL