TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P53838|YN15_YEAST Hypothetical 65.0 kDa protein in MET2-SEC2 intergenic region - Saccharomyces cerevisiae (Baker's yeast).
MSNESTRVTVSRGCTASDECAQALERTNDELDRESSVSESRSDEESHEKLSRRRFPTLGIGIWLDLKDRIPYYKSDWVDA
FNYRVIPSIVDTYFNNLLPAIAFAQDMFDRTDNSYGVNEVLLSSAMAGIVFGVLGGQPLCIVGVTGPISIFNYTVYEIIK
PLNTSYFGFMFWICMWSMIFHLVLAFTNAVCLLQYVTTFPCDIFGLFINVVYIQKGIQILTRQFSAKSGEKSVQDGFASV
VVALVMTAFGLFFKLFHYYPLFSHRIRTFISDYSTALSVLFWSSFTHFGGYLHDVKFKKLPITKAFFPTSKVNRPQNTWL
AYEPIPVKDVFIALPFGIFLTILFYFDHNVSSLMAQRHQYKLKKPSSFHYDFALLGLTTCISGVLGIPAPNGLIPQAPLH
TETLLVRDSNQKVISCVEQRFTNTFQGLMILGTMTRPLLVCLGEIPQAVLSGLFFIMGINGLMTNSIIQRLVFLFSDPNR
RDNTSPLMKVSKKSMLIFLSFSLTGFAGEFAITNTIAAIGFPLVLLLSVLVSFSFAYIFPTEELKILDTNVAQKFTIKNL
LLENIRDAKFCDKHED