TCDB is operated by the Saier Lab Bioinformatics Group
>P54537|YQIZ_BACSU Probable amino-acid ABC transporter ATP-binding protein yqiZ - Bacillus subtilis.
MIKVEKLSKSFGKHEVLKNISTTIAEGEVVAVIGPSGSGKSTFLRCLNLLEKPNGGTITIKDTEITKPKTNTLKVRENIG
MVFQHFHLFPHKTVLENIMYAPVNVKKESKQAAQEKAEDLLRKVGLFEKRNDYPNRLSGGQKQRVAIARALAMNPDIMLF
DEPTSALDPEMVKEVLQVMKELVETGMTMVIVTHEMGFAKEVADRVLFMDQGMIVEDGNPKEFFMSPKSKRAQDFLEKIL