TCDB is operated by the Saier Lab Bioinformatics Group
>sp|P54710|ATNG_HUMAN SODIUM/POTASSIUM-TRANSPORTING ATPASE GAMMA CHAIN (SODIUM PUMP GAMMA CHAIN) (NA+/K+ ATPASE GAMMA SUBUNIT) (FXYD DOMAIN-CONTAINING ION TRANSPORT REGULATOR 2) - Homo sapiens (Human).
MTGLSMDGGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP